Newly characterized P. aeruginosa
PAO1 gene rsaL
The gene name rsaL (lasR spelled backwards) was chosen because the function
of RsaL is converse to that of LasR, i.e. it is a repressor of quorum-sensing
controlled genes; whereas, LasR is a positive regulator of quorum-sensing
genes. Furthermore, rsaL is juxtaposed to the lasR gene (with a one a.a.
overlap), but on the opposing strand. This gene exhibits no sequence homology
with any known genes or proteins. However, it was found to be a negative
regulator of P. aeruginosa quorum sensing. The action of this
repressor was shown to be mediated via decreasing expression of the P.
aeruginosa autoinducer synthase gene, lasI.
Protein Sequence of RsaL:
MASHERTQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLLHFY
IEGQITDRQLADLRGKIRE
Located on Contig 53, from 832870 to 832631 (3/15/99 genome sequence
version)
See the following reference for more information:
Teresa de Kievit, Patrick C. Seed, Jonathon Nezezon, Luciano Passador,
and Barbara H. Iglewski 1999. RsaL, a Novel Repressor of Virulence Gene
Expression in Pseudomonas aeruginosa. J. Bacteriol. 181: 2175-2184
Barbara H. Iglewski, University of Rochester; Luciano Passador, University
of Rochester
Patrick C. Seed, University of Rochester; Jonathon Nezezon, University
of Rochester
Pseudomonas
aeruginosa Community Annotation Project