P. aeruginosa PAO1 known and proposed outer membrane proteins

This is not a complete list of all outer membrane proteins at this time and both gene identification and annotation description is currently under development. Some of these sequences below are not predicted to be OMPs with a high degree of confidence - this table should therefore be considered a list of sequences that could be targeted for further evaluation of cellular localization. Peptidoglycan-binding proteins, which may or may not be OMPs (some are likely not), are listed separately below.

CONTIG FROM TO +/-  PROTEIN ALT PROT GENE ALT GENE FUNCTION CONTEXT FEATURE HOMOLOGY COMMENTS
Contig43 1754 4084 + outer membrane protein XqhA (type II secretion)   xqhA         ref: 98343806  PseudoCAP(HancockOMP):
Contig43 16634 17908 + probable outer membrane protein opml precursor     opmL Probable outer membrane protein that may be involved in efflux or secretion (based on similarity with other OMPs and based to some extent on gene context).  Upstream (by about 1 kb though) is a divergently transcribed probable inner membrane protein and downstream is a possible other tranporter component possibly involved in secretion.   : Most similar to Pseudomonas putida agglutination protein. Similar also to OprM and other outer membrane proteins involved in efflux or secretion. PseudoCAP(HancockOMP):
Contig43 54324 56483 - outer membrane protein ferripyochelin receptor fpta   fptA   Ferripyochelin uptake. Iron regulated.     U03161:  PseudoCAP (HancockOMP): 
Contig44 30608 31990 + probable outer membrane porin opre precursor porin e1, porin e oprE   Anaerobically induced porin of unknown function.     D12711: To other known or probable outer membrane proteins that are members of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): Start site at 30608 as previously reported (Genemark didn't call this)
Contig44 71786 73729 - Possible autotransporter             Possible autotransporter. C-terminus like esterase/lipases ('GDSL' FAMILY) which are associated with the outer membrane, while N-terminus is like aminopeptidases PseudoCAP(HancockOMP):
Contig44 179656 181110 + outer membrane protein oprm precursor formerly oprk oprM oprK Outer membrane component of a multidrug efflux system. Downstream of mexA and mexA - the other components of this operon involved in efflux. N-terminal signal sequence. L23839: To other outer membrane proteins involved in efflux (most similar to OprJ). Member of the "OprM family" of outer membrane proteins known or probably involved in efflux. PseudoCAP (HancockOMP): Demonstrated outer membrane protein that has been studied extensively (structually and functionally). Formerly called OprK, but this name is not used any more. This first sequence of oprM from PAO1 reported in Genbank had errors at its 3' end due to a cloning problem - this has been corrected in a subsequent Genbank sequence submission.
Contig44 188287 190476 + probable outer membrane ton-b dependent receptor     optJ Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig45 29254 31660 - outer membrane protein hydroxamate-type ferrisiderophore receptor fiua   fiuA   Hydroxamate-type ferrisiderophore uptake? Iron regulated.     :  PseudoCAP (HancockOMP): Sequence differences near 30580 and 29444 with previously obtained sequence. The latter difference causes a frame shift.
Contig45 153025 155799 - probable outer membrane protein             Most similar to Imp (Organic Solvent Tolerance Protein) of E. coli PseudoCAP (HancockOMP): Sequence differences near 30580 and 29444 with previously obtained sequence. The latter difference causes a frame shift.
Contig46 5133 7544 - probable outer membrane protein ferric siderophore receptor ufra   ufrA   Probable ferric siderophore uptake.     :  PseudoCAP(HancockOMP):
Contig46 20768 22726 + probable outer membrane receptor     optT Probable outer membrane receptor. Not studied experimentally.     :  PseudoCAP (HancockOMP): Not confident about start site.
Contig46 81244 82443 + hypothetical protein - possible outer membrane protein             No significant similarities. Low similarities are to outer membrane proteins and PSORT and structural features suggest this is an OMP PseudoCAP(HancockOMP):
Contig46 174478 177087 + probable outer membrane receptor protein     optK Probable outer membrane receptor. May be a member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.   No cleavable signal sequence predicted by PSORT :  PseudoCAP (HancockOMP): Not confident about start site. Possible better RBS upstream of string of possible GTG start sites around 174550.
Contig46 192816 195452 - probable outer membrane receptor protein     optM Probable outer membrane receptor. May be a member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig46 221276 223924 + probable outer membrane ton-b dependent receptor     optL Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig46 246818 248047 - probable outer membrane porin protein precursor     opdO Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig46 267126 269744 + Probable outer membrane usher protein             Three other paralogs in genome. PseudoCAP(HancockOMP):
Contig46 355575 356825 + probable outer membrane porin protein precursor     opdG Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK and Pseudomonas aeruginosa OprE. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig46 380772 381542 + probable lipoprotein             probably an outer membrane lipoprotein, based on similarity with others of the BexD/CtrA/VexA family. PseudoCAP(HancockOMP):
Contig46 439691 441820 - probable outer membrane ton-b dependent receptor     optQ Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig46 444517 445875 + probable outer membrane protein precursor     opbA       X77131 : Similar to P. aerugiosa OprB. PseudoCAP(HancockOMP):
Contig47 152484 153266 + probable outer membrane lipoprotein             Most similar to a Helicobacter pylori OMP and then to other OM lipoproteins including E. coli NlpA. Very highly similar paralog (98%?) and a lower similarity paralog are in the genome. PseudoCAP(HancockOMP):
Contig47 260932 262620 + probable outer membrane protein             Similar to outer-membrane hemolysin activator transporter proteins but most similar to Erwinia chrysanthemi HecB. Very high similarity (approximately 98%) to a paralog in the genome. Lower similarity (Expect values of around 1e -10) to three other paralogs.  PseudoCAP(HancockOMP):
Contig47 269000 279616 + possible outer membrane associated antigen             Similar to filamentous hemagglutinin [Bordetella pertussis] and various antigens/OMPs. Notable large size and large gap in sequence similarity in the middle of the sequence. Member of a possible family of (9?) proteins - one of which is most similar to E. coli Flu PseudoCAP(HancockOMP): Start site not clear and not at all determined due to large size and lack of correct genemark calls in this area (I.e. genemark called the other strand and missed this orf).
Contig47 336239 337159 - probable outer membrane protein             weak similarity to putative E. coli OMP and S. plombe and C. elegans hypothetical proteins. Two other paralogs present in genome which share no significant similarity with other proteins but have good PSORT scores. PseudoCAP(HancockOMP):
Contig47 337192 338595 - probable outer membrane porin protein precursor     opdJ Probable porin. Not experimentally studied.     : Most similar to Pseudomonas aeruginosa OprD and OprD3. Proposed member of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): Start should probably be at 338595, based on signal sequence motifs.
Contig47 383907 386306 - outer membrane protein ferripyoverdine receptor fpva   fpvA   Ferripyoverdin uptake. Iron regulated.     L10210:  PseudoCAP (HancockOMP): Some differences between previously obtained sequence and geomic sequence in region between 384140 to 384060.
Contig47 394814 396229 - probable outer membrane protein opmq precursor     opmQ Probable outer membrane protein that resembles those involved in efflux.  No obvious genes flanking that would be involved in an efflux operon, though there is a probable membrane fusion protein gene two genes upstream and so similarity may simply be getting below the limits of BLAST.    : Most similar to OprM and other outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP(HancockOMP):
Contig47 444760 445431 - probable outer membrane lipoprotein             Most similar to hypothetical and them studied OM lipoproteins including E. coli NlpA. 2 paralogs are in the genome (these two are highly similar to each other). PseudoCAP(HancockOMP):
Contig47 462023 464389 - probable outer membrane ton-b dependent receptor     optO Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig48 1521 3758 - outer membrane protein ferric enterobactin receptor pfea   pfeA   Ferrienterobactin uptake. Expressed under conditions of iron limitation and when enterobactin is present.     M98033:  PseudoCAP (HancockOMP): 
Contig48 66839 67660 - probable outer membrane protein             42% similar to gene IV integral membrane protein of filamentous phages such as M13. In these phages this protein is predicted to have a beta-sheet structure similar to bacterial OMPs (see UI: 90172422) PseudoCAP(HancockOMP):
Contig48 110537 113188 + probable outer membrane receptor     optF Probable outer membrane receptor. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig48 168436 170175 + probable outer membrane protein             Most similar to E. coli hypothetical, but signficant similarity (52%) to a Neisseria meningitidis omp85 and others. One weak paralog is present in the genome (this paralog is similar to the same proteins). PseudoCAP(HancockOMP):
Contig48 196220 197713 + probable outer membrane protein opmb precursor     opmB Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based on gene context).  Upstream is encoded a membrane fusion protein followed by TWO cytoplasmic membrane (pump) comonents of a probable efflux operon. Usually for efflux operons there is one membrane fusion protein gene, followed by a pump protein gene, followed by the outer membrane protein gene constituent.   : Most similar to OprM and other outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP (HancockOMP): Member of a somewhat unusual cluster of efflux genes (see genomic context and PseudoCAP web page for more info)
Contig48 200694 201977 + probable outer membrane protein opmn precursor     opmN, czcC? Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based on gene context). Possibly similar function to Alcaligenes eutrophus czcC which plays a role in divalent cation efflux. Downstream of genes with signficant similarity to cation efflux components of the czc operon in Alcaligenes eutrophus.    : Most similar to Alcaligenes eutrophus CzcC (61%) though also signficant similarity to other outer membrane proteins implicated in efflux of other compounds. PseudoCAP (HancockOMP): Perhaps this gene should be called czcC, however I'm a bit hesitant without more study.
Contig48 220079 221425 + outer membrane porin protein oprd3 precursor oprd2-like oprD3   Probable porin. Not experimentally studied.     AF033849: To other known or probable outer membrane proteins that are members of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): 27bp downstream of Genemark-called ORF start is the start previously reported in a Genbank submission (no accompanying publication has ever come out for this gene). This Genbank submission is probably the correct one, though it is not completely obvious.
Contig48 229390 230805 - outer membrane protein oprn precursor   oprN   Outer membrane component of multidrug efflux system Downstream of genes mexE and mexF - the other components of this operon involved in efflux.   X99514: To other outer membrane proteins involved in efflux. Member of the "OprM family" of outer membrane proteins known or probably involved in efflux. PseudoCAP (HancockOMP): Demonstrated outer membrane protein that has been functionally studied. Two frame shift errors probably between 229905 to 229726 since comparison of deduced protein sequences reveals there is a region of amino acid sequence there with no similarity to the previously sequenced oprN and this region is filled with the arginines and prolines - characteristic of an out of frame translation. (correct translation of region: AASTADVGVATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSVGPSISWAAFDLGSVRA)
Contig48 251182 252123 - hypothetical protein - possible outer membrane protein             No significant similarities except to two paralogs within the genome which also have little sequence similarity to anything (except low similarity to OMPs and good PSORT scores that suggest they may be OMPs) PseudoCAP(HancockOMP):
Contig48 258647 261232 + probable outer membrane ton-b dependent receptor     optS Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.   start site not clear - PSORT: uncleavable signal sequence :  PseudoCAP(HancockOMP):
Contig48 263385 265082   probable outer membrane protein             most similar to HecB [Erwinia chrysanthemi] and then to hemolysin activator OMPs. Very high similarity (approximately 98%) to a paralog in the genome. Lower similarity (Expect values of around 1e -10) to three other paralogs.  PseudoCAP(HancockOMP):
Contig48 393330 395714 + probable outer membrane ton-b dependent receptor     optP Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig48 406876 408210 + probable outer membrane porin protein precursor     opdC Probable porin. Not experimentally studied.     : Most similar to Pseudomonas aeruginosa OprD and OprD3. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig48 411402 412238 + probable outer membrane protein             similar to a few OMPs including Vibrio parahaemolyticus OmpK and S. typhimurium nucleoside specific porin Tsx. PseudoCAP(HancockOMP):
Contig48 437832 439190 - probable outer membrane porin protein precursor     opdI Probable porin. Not experimentally studied.     : Most similar to Pseudomonas aeruginosa OprD. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig48 441454 443823 + probable outer membrane ton-b dependent receptor     optZ Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig48 485971 486804 + probable outer membrane protein             little sequence similarity (very low to Neisseria Opa proteins). One other ORF in the genome shares low similarity. PseudoCAP(HancockOMP):
Contig48 492855 494120 - probable outer membrane porin protein precursor     opdF Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK and Pseudomonas aeruginosa OprE. Proposed member of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): Start should be at 494120 based on multiple alignment of the OprD family.
Contig49 9103 10809 + probable outer membrane protein             similar to outer-membrane hemolysin activator transporter proteins including HecB. Similar to 4 other paralogs PseudoCAP(HancockOMP):
Contig49 44380 45816 + outer membrane protein oprj precursor   oprJ   Outer membrane component of multidrug efflux system Downstream of mexC and mexD - the other components of this operon involved in efflux.   U57969: To other outer membrane proteins involved in efflux (most similar to OprM). Member of the "OprM family" of outer membrane proteins known or probably involved in efflux. PseudoCAP (HancockOMP): Demonstrated outer membrane protein that has been functionally studied.
Contig49 50918 52396 + probable outer membrane protein opmf precursor     opmF Probable outer membrane protein that resembles those involved in efflux or secretion. However, gene context does not strongly support any particular possible function. No obvious genes flanking that would comprise the other comonents of an efflux operon, though the flanking genes have some low similarity with ABC tranporters/membrane fusion proteins (MFPs) so there may be an MPF for example, however the level of similarity is getting below the abilities of BLAST.    : Most similar to AprF, an outer membrane protein involved in protease secretion, and lower similarity in conserved regions to OprM and other outer membrane proteins that are known to be involved in efflux. PseudoCAP(HancockOMP):
Contig49 55017 56402 + probable outer membrane protein             Similar to E. coli OMP FadL for fatty acid transport and H. influenzae OMP P1. Two paralogs are present in the genome.  PseudoCAP(HancockOMP):
Contig49 91283 94768 - pilin biosynthesis protein   pilY1         Note: located experimentally in both the outer membrane and external fimbrial fractions, so its unclear whether this is an OMP or not. PseudoCAP(HancockOMP):
Contig49 94780 95367 - pilin biosynthesis protein pilX - outer membrane protein that is a probable lipoprotein   pilX         Similar to lipoproteins. Demonstrated experimentally to be associated with the outer membrane PseudoCAP(HancockOMP):
Contig49 102465 103490 - probable lipoprotein             Most similar to Neisseria gonorrhoeae ComL lipoprotein (62%) that is peptidoglycan associated.. PseudoCAP(HancockOMP):
Contig49 113057 114694 - probable outer membrane protein             similar to outer-membrane hemolysin activator transporter proteins including HecB. Similar to 4 other paralogs PseudoCAP(HancockOMP):
Contig49 139574 141832 + outer membrane protein hydroxamate-type ferrisiderophore receptor piua   piuA   Hydroxamate-type ferrisiderophore uptake? Iron regulated.     AF051690:  PseudoCAP(HancockOMP):
Contig49 155097 156548 - probable outer membrane porin protein precursor     opdP Probable porin. Not experimentally studied.     : Most similar to Pseudomonas aeruginosa OprD and OprD3. Proposed member of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): Start should be 156548.
Contig49 167220 168029 + hypothetical protein - possible outer membrane protein             Similar to an E. coli hypothetical protein. One paralog in the genome which shares low similarity to OMPs. Both are in a region containing E. coli homologs of no known function and the region begins with two component regulators. PseudoCAP(HancockOMP):
Contig49 176700 177491 + hypothetical protein - possible outer membrane protein             Similar to an E. coli hypothetical protein and very low similarity to some OMPs. One paralog in the genome. Both are in a region containing E. coli homologs of no known function and the region begins with two component regulators. PseudoCAP(HancockOMP):
Contig49 178034 178411 - probable outer membrane lipoprotein             Similar to E. coli rare lipoprotein A though more similar to homologs identified in microbial genomes PseudoCAP(HancockOMP):
Contig49 365820 367070 + probable outer membrane protein (possibly for a type II secretion pathway)             most similar to a Rhizobium sp. hypothetical protein and then to general secretory pathway OMPs  PseudoCAP(HancockOMP):
Contig49 425579 427804 - probable outer membrane ton-b dependent receptor     optH Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig49 433591 434208 - LOLB PRECURSOR - PROBABLE OUTER MEMBRANE LIPOPROTEIN                PseudoCAP(HancockOMP):
Contig49 441003 441524 + probable outer membrane protein             probable OMP with no high similarities - only weak similarities OMPs including Nterm of OprF and contains signal sequence and hydrophobicity consistent with an OMP PseudoCAP(HancockOMP):
Contig49 451041 453413 - probable outer membrane protein - possible usher protein             Three other paralogs in genome. PseudoCAP(HancockOMP):
Contig50 25315 27987 + probable outer membrane protein hasr   hasR   Probably involved in utilization of haemoglobin iron, functioning as the outer membrane receptor for a haemophore-dependent haem acquisition system. Not studied experimentally, though its porbable partner hemophore, HasA has been studied.     CAA70172: Highly similar to Serratia marcescens HasR. Probable ortholog. PseudoCAP(HancockOMP): 
Contig50 32038 33390 + probable outer membrane protein opmm precursor     opmM Probable outer membrane protein that may be involved in secretion (based on similarity with other OMPs and based on gene context).  Downstream of genes that are likely components of a secretion machinery   : Most similar to AprF, an outer membrane protein, and also similar to other OMPs that are members of this secretion family. PseudoCAP(HancockOMP):
Contig50 168329 169645 + outer membrane protein OprO precursor porin O oprO   Porin specific for pyrophosphate uptake. Inducible by low phosphate or in stationary phase.     M86648 : Significant similarity to P. aeruginosa OprP. PseudoCAP(HancockOMP): Previously called polyphosphate-specific porin but now called OprO.
Contig50 170104 171426 + outer membrane protein OprP precursor porin P oprP   Porin specific for phosphate uptake. Inducible by low phosphate.     X53313 : Significant similarity to P. aeruginosa OprO. PseudoCAP(HancockOMP): Previously called Porin P but now called OprP (since porin P is not an easily searchable term in Medline etc?). Please note that there is a mixup in Genbank regarding OprD, OprP, and OprB. Please use Genbank accessions reported here.
Contig50 184501 186663 + probable outer membrane ton-b dependent receptor     optR Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP (HancockOMP): Not confident about start site.
Contig50 215283 216086 - probable outer membrane lipoprotein precursor             most similar to Rickettsia prowazekii and E. coli VacJ sequences. One paralog in the genome. PseudoCAP(HancockOMP):
Contig50 265376 266740 + outer membrane porin OprB precursor D1 oprB   Glucose/sugar uptake. Inducible by glucose.     X77131 :  PseudoCAP(HancockOMP):
Contig50 356328 358301 - outer membrane protein XcpQ precursor   xcpQ   Type II protein secretion     X68594 :  PseudoCAP(HancockOMP):
Contig50 382723 384687 + hypothetical protein - possible outer membrane protein?             Similar to P. fluorescens hypothetical protein PseudoCAP(HancockOMP):
Contig50 440707 441972 - probable outer membrane porin protein precursor     opdQ Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig50 574655 576808 - probable outer membrane ton-b dependent receptor     optE Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig50 635491 635739 - lipoprotein OprI precursor porin I, Lipoprotein I oprI   Structural function. Lipoprotein.     M25761 :  PseudoCAP(HancockOMP):
Contig50 651006 652442 - probable outer membrane protein opma precursor     opmA Probable outer membrane protein that resembles those involved in efflux.  Two genes upstream may be involved in an efflux mecahnism   : Most similar to OprN and other outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP(HancockOMP):
Contig50 685091 685795 + probable outer membrane lipoprotein precursor             49% similar to Shigella flexneri VacJ lipoprotein precursor. One paralog in the genome. PseudoCAP(HancockOMP):
Contig50 721307 722584 - probable outer membrane porin opre3 precursor   oprQ oprE3 Porin. Experimental study of this protein has not yet been published.     AB006797: To other known or probable outer membrane proteins that are members of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): 
Contig50 787508 788815 - probable outer membrane porin protein precursor     opdB Probable porin. Not experimentally studied.     : Most similar to Pseudomonas aeruginosa OprD. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig51 43019 43969 - probable outer membrane protein             No significant similarities except to two paralogs within the genome which also have little sequence similarity to anything (except low similarity to OMPs and PSORT scores that suggest they may be OMPs) PseudoCAP(HancockOMP):
Contig51 98534 98671 - lipprotein LppL precursor   lppL   Lipoprotein of unknown function     X51393 :  PseudoCAP(HancockOMP):
Contig51 232853 234328 - probable outer membrane protein opmg precursor     opmG Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based on gene context).  P. aeruginosa pmrA and pmrB are immediately downstream of this gene. These genes encode MFP and pump proteins that form part of an efflux machinery and so this OpmG gene is likely the outer membrane component of this cluster. However this is a somewhat atypical order for efflux genes - ususally the OMP component is encoded downstream of the MFP and pump. There is also a marR-like regulatory gene upstream. atypical N-terminal signal sequence : Most similar to outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP(HancockOMP): Note that P. aeruginosa PmrA and PmrB should probably be renamed (MegA and MegB to follow other nomenclature for efflux genes?) since PmrA and PmrB are widely known two-component regulators (studied primarily in S. typhimurium) that have orthologs in P. aeruginosa.
Contig51 288477 289046 + hypothetical protein - probable outer membrane lipoprotein (lipocalin)             Similar to outer membrane lipoprotein (lipocalin) Blc of Citrobacter freundii and E. coli. Member of the lipocalin family. No paralogs in the genome. PseudoCAP(HancockOMP):
Contig51 361571 362095 + fimbrial biogenesis protein PilP - proposed lipoprotein   pilP           PseudoCAP(HancockOMP):
Contig51 362110 364293 + outer membrane protein for fimbrial assembly, PilQ   pilQ           PseudoCAP(HancockOMP):
Contig51 375138 376118   hypothetical protein - probable outer membrane protein             Most similar to human agreggan precursor PseudoCAP(HancockOMP):
Contig51 454460 455905 - probable outer membrane protein precursor opmh. possible e. coli tolc ortholog. opmh   opmH, tolC Probable outer membrane protein that may be the ortholog of Escherichia coli TolC. TolC is required for proper expression of various E. coli outer membrane proteins.  Both upstream and downstream are divergently transcribed genes so this gene is probably monocistronic. Both upstream and downstream genes are not involved in efflux mechanisms (i.e. upstream is the probable thiC ortholog for thiamin biosynthesis), though this ORF does share similarity with OMP genes involved in efflux. However, due to this gene context and its similarity with TolC, it is likely a TolC ortholog.   : ORF with highest similarity to E. coli TolC over any other ORF in the P. aeruginosa genomic sequence. Also similar to outer membrane proteins involved in efflux. PseudoCAP(HancockOMP):
Contig51 544292 545545 + probable outer membrane porin protein precursor     opdK Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig51 545695 548661 - probable outer membrane ton-b dependent receptor     optI Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP (HancockOMP): Not confident about start site.
Contig51 610163 612286 + probable outer membrane ton-b dependent receptor     optC Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig51 687303 687830 - lipoprotein OprX precursor lipoprotein oprX   Structural function. Lipoprotein. Though data not yet published.     AF050676 :  PseudoCAP(HancockOMP):
Contig51 748498 750789 - outer membrane protein hemin receptor phur   phuR   Hemin uptake. Iron regulated.     AF055999:  PseudoCAP (HancockOMP): 
Contig52 3420 4880 - probable outer membrane protein opmd precursor     opmD Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based on gene context).  Downstream of the proposed genes meaD and mebD - the other probable components of an operon which may be involved in efflux.   : Most similar to OprN and other outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP(HancockOMP):
Contig52 10196 11362 - hypothetical protein - probable outer membrane protein             weak similarity to E. coli TolB - better similarity with YkgB of Bsubtilis PseudoCAP(HancockOMP):
Contig52 39260 40555 - probable outer membrane porin protein precursor     opdN Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK and Pseudomonas aeruginosa OprE. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig52 49240 51645 - probable outer membrane ton-b dependent receptor     optB Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig52 63005 65122 + probable outer membrane ton-b dependent receptor     optV Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig52 77790 79202 - probable outer membrane protein opmk precursor     opmK Probable outer membrane protein that may be involved in efflux or secretion (based on similarity with other OMPs and based to some extent on gene context).  Downstream of possible other components of an efflux or secretion machinery.   : Most similar to Bordetella pertussis CyaE (49%) and also similar to other outer membrane proteins that are known to be involved in efflux or secretion. PseudoCAP(HancockOMP):
Contig52 87582 88838 - probable outer membrane porin protein precursor     opdL Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig52 147545 150079 + probable outer membrane protein - possible usher protein             Three other paralogs in genome. PseudoCAP(HancockOMP):
Contig52 150904 153960 + probable outer membrane protein             Most similar to high-molecular-weight surface-exposed protein HMW1 of Haemophilus influenzae and then E. coli Antigen 43 variable OMP (Flu). One of a number (9?) of Flu homologs - this one is the most similar to Flu. PseudoCAP(HancockOMP):
Contig52 170198 170893 - outer membrane protein OprG precursor porin G oprG   Demonstrated outer membrane protein whose gene was isolated by comparision of a determined N-terminal protein sequence with the Pseudomonas aeruginosa genome sequence. This protein has been studied but is still of unknown function. Low level constitutive expression. Induced in high iron, high Mg2+.     :  PseudoCAP(HancockOMP): Publication associated with the identification of the gene corresponding to this protein has recently come out but in not in Medline yet (Gensberg, K., A.W. Smith, F.S.L. Brinkman, and R.E.W. Hancock (1999). Identification of oprG, a gene encoding a major outer membrane protein of Pseudomonas aeruginosa. Journal of Antimicrobial Chemotherapy. 43:607-608.). Sequence has not yet come out in Genbank.
Contig52 245264 245887 - probable lipoprotein             low similarity to a variety of lipoproteins PseudoCAP(HancockOMP):
Contig52 307912 308691 - Probable outer membrane lipoprotein             Most similar to a Helicobacter pylori OMP and then to other OM lipoproteins including E. coli NlpA. Very highly similar paralog (98%?) and a lower similarity paralog are in the genome. PseudoCAP(HancockOMP):
Contig52 344309 346669 - probable outer membrane protein for iron dicitrate transport, feca   fecA   Not studied experimentally, but its probable ortholog, E. coli FecA, is an outer membrane protein involved in iron dicitrate transport.     P13036: Most similar to Escherichia coli FecA PseudoCAP (HancockOMP): 
Contig52 352483 354000 + probable outer membrane protein opmi precursor     opmI Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based to some extent on gene context).  Upstream of other possible components of an efflux operon. However level of similarity is low. This gene oranization is somewhat unusual for an possible efflux operon in that usually the outer membrane component gene is downstream of the other efflux component genes in an operon. Start site not obvious (usually it is obvious because of signal sequence feature). Unusual similarities. Most similar to Burkholderia cepacia fusA (73%) but only in one region (N-terminal region of fusA is similar to central region of this ORF). However, similar over entire length to outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP (HancockOMP): Possible horizontal transfer of portion of gene (not necessarily horizontal transfer between B. cepacia and P. aeruginosa and may involve just B. cepacia or just P. aeruginosa - needs to be looked into further). Better start site confirmation in B. cepacia and P. aeruginosa genes would be a start, and then need to examine similarities between different domains of the protein and related domains in other orgnaisms genes to examine the source of this mosaic structure.
Contig52 465622 467790 + outer membrane protein for copper transport, oprc outer membrane protein c oprC   Outer membrane porin involved in copper transport. Induced under anaerobic conditions, and repressed in the presence of copper.     D28119:  PseudoCAP (HancockOMP): 
Contig52 628042 630435   Probable outer membrane protein             Highly similar (51%) to outer membrane proteins Omp87 and Omp85 from Pasteurella multocida and Neisseria meningitidis, respectively, as well as other OMPs. Most similar to an unstudied E. coli protein. One other weak paralog in the genome. PseudoCAP(HancockOMP):
Contig52 693575 694825 + probable outer membrane porin protein precursor     opdR Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK and Pseudomonas aeruginosa OprE. Proposed member of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): Start should probably be at 693575
Contig52 745575 747047 - outer membrane protein AlgE precursor   algE alg76 Putative export of alginate. Demonstrated porin function. Anion selective consistent with possible specificity for polymannuronic acid - GDP-mannuronic acid can block channel function.     M37181 :  PseudoCAP(HancockOMP):
Contig52 776001 777473 + probable outer membrane protein opme precursor     opmE Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based on gene context).  Downstream of the proposed genes meaE and mebE - the other proposed components of an operon which may be involved in efflux.   : Most similar to OprN and other outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP(HancockOMP):
Contig52 800158 801378   probable outer membrane protein             Low similarity to an E. coli usher, but hydrophobicity score suggests its an OMP PseudoCAP(HancockOMP):
Contig52 829187 829783 - hypothetical protein - probable lipoprotein             Similar to E. coli Spr lipoprotein and other probable lipoproteins of the NlpC family. Two other paralogs present in genome. PseudoCAP(HancockOMP):
Contig53 15663 18074 + probable outer membrane protein for type II secretion             56% similar to P. aeruginosa XcpQ PseudoCAP(HancockOMP):
Contig53 22400 23512 + alkaline phosphatase paralog?             77% similar to alk phos P. aeruginosa gene PseudoCAP(HancockOMP):
Contig53 37395 39029 + probable outer membrane protein             similar to outer-membrane hemolysin activator transporter proteins (39% to HecB of Erwinia chrysanthemi). Similar to 4 other paralogs PseudoCAP(HancockOMP):
Contig53 96654 97937 - probable outer membrane porin protein precursor     opdH Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK and Pseudomonas aeruginosa OprE. Proposed member of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): Start site should be 97937 based on multiple alignment of this sequence with others of the OprD family
Contig53 122995 125058 - probable outer membrane protein - TonB dependent             most similar to TonB dependent OMP hemin receptors PseudoCAP(HancockOMP):
Contig53 195532 197544 - conserved hypothetical protein             possible outer membrane protein but only highly similar to other hypothetical proteins PseudoCAP(HancockOMP):
Contig53 291970 294195 + outer membrane protein phenolate-type ferrisiderophore receptor pira   pirA   Phenolate-type ferrisiderophore uptake?? Iron regulated.     : PseudoCAP(HancockOMP):
Contig53 317723 319054 - outer membrane porin protein oprd precursor porin d, porin d2, oprd2 oprD   Porin specific for basic amino acid and imipenem uptake.     X63152: To other known or probable outer membrane proteins that are members of the OprD family of outer membrane proteins. PseudoCAP (HancockOMP): 
Contig53 331140 331646 + peptidoglycan-associated lipoprotein OprL precursor PAL, H2 oprL   Strucural function. Stabilizes the outer membrane.     Z50191 : To other PALs and other proteins that bind peptidoglycan PseudoCAP(HancockOMP):
Contig53 348524 351043 + probable outer membrane usher protein             The ORF is most similar to E. coli fimD (53%) over all other paralogs (3) identified. Similar to other usher proteins. PseudoCAP(HancockOMP):
Contig53 384686 385936 + probable outer membrane porin protein precursor     opdD Probable porin. Not experimentally studied.     : Most similar to Pseudomonas putida PhaK. Proposed member of the OprD family of outer membrane proteins. PseudoCAP(HancockOMP):
Contig53 415009 415473 + Probable outer membrane lipoprotein SlyB   slyB         60% to E. coli SlyB PseudoCAP(HancockOMP):
Contig53 438434 438874 + probable FLAGELLAR BASAL-BODY ROD PROTEIN FLGC             60% to E. coli FlgC PseudoCAP(HancockOMP):
Contig53 442861 443556 + Probable Flagellar L-ring protein precursor FlgH             60% to Pseudomonas putida FlgH (though frame shift near N-terminus) PseudoCAP(HancockOMP):
Contig53 550755 551354 + outer membrane protein OprH precursor porin H, outer membrane protein H1 oprH   Polycation/EDTA resistance. Induced in low Mg2+, Sr2+, Mn2+ and Ca2+.     M26954 :  PseudoCAP(HancockOMP): note that this protein is now referred to as OprH, unlike what is mentioned in the Genbank entry
Contig53 573307 573924 + hypothetical protein - probable lipoprotein             Similar to E. coli Spr lipoprotein and other probable lipoproteins of the NlpC family. Two other paralogs present in genome. PseudoCAP(HancockOMP):
Contig53 574007 574540 + hypothetical protein - probable lipoprotein             Similar to E. coli Spr lipoprotein and other probable lipoproteins of the NlpC family. Two other paralogs present in genome. PseudoCAP(HancockOMP):
Contig53 612830 614275 - probable outer membrane protein opmj precursor     opmJ Probable outer membrane protein that may be involved in efflux (based on similarity with other OMPs known to be involved in efflux and based on gene context).  Upstream of other possible components of an efflux operon (i.e. a membrane fusion protein gene and pump protein gene). This gene oranization is somewhat unusual for an possible efflux operon in that usually the outer membrane component gene is downstream of the other efflux component genes in an operon.   : Most similar to OprN (51%) and other outer membrane proteins that are known to be involved in efflux. Proposed member of the "OprM family" of outer membrane proteins. PseudoCAP(HancockOMP):
Contig53 627576 629018 + alkaline protease secretion protein aprf precursor   aprF   Outer membrane component of alkaline protease secretion machinery. Downstream of aprD and aprE as part of this gene cluster. Based on similarity with an AprF homolog in the P. aeruginosa genome, and based on signal sequence features, the start site may actually be at 627582 (6 bp or "2 aa" downstream of the original predicted site). However, the ribosome binding site location is more consistent with the 627576 start site.  X64558: To other outer membrane proteins involved in secretion. PseudoCAP (HancockOMP): 
Contig53 655552 657399 + probable outer membrane protein receptor   optG btuB Not studied experimentally. The most similar gene, E. coli btuB, is required for vitamin B12 uptake.     :  PseudoCAP (HancockOMP): Too short? 655372 still a very possible start.
Contig53 672979 674253 - probable outer membrane protein             Most similar to E. coli OMP FadL for fatty acid transport and H. influenzae OMP P1. Also similar the Pputida TodX. Two paralogs are present in the genome.  PseudoCAP(HancockOMP):
Contig53 685335 687890 + probable TonB-dependent outer membrane heme receptor             highly similar to TonB-dependent heme receptor from haemophilus ducreyi PseudoCAP(HancockOMP):
Contig53 706916 709111 + outer membrane protein hydroxamate-type ferrisiderophore receptor pfua   pfuA aleB Hydroxamate-type ferrisiderophore uptake? Iron regulated.     AF051693:  PseudoCAP (HancockOMP): 
Contig53 750132 752570 + probable outer membrane ton-b dependent receptor     optN Probable outer membrane receptor. Proposed member of the TonB-dependent family of outer membrane protein receptors. Not studied experimentally.     :  PseudoCAP(HancockOMP):
Contig53 772561 774840 + probable outer membrane protein (possibly for a type II secretion pathway)             Highly similar to protein required for the secretion of paracrystalline surface array subunits (S-layer) through the outer membrane of the fish pathogen Aeromonas hydrophila. Lesser, but still strong similarity to OMPs from E. coli and others for the general secretion pathway PseudoCAP(HancockOMP):
Contig53 775359 777164   probable outer membrane protein             low similarity to some OMPs, including OmpB of Rickettsia rickettsii and (lesser) OpcP1 from Burkholderia cepacia. PSORT is a good score. PseudoCAP(HancockOMP):
Contig53 1030237 1032345 - probable outer membrane protein - TonB dependent             most similar to colicin I receptor OMP of E. coli (TonB dependent OMP) PseudoCAP(HancockOMP):
Contig53 1132501 1135041 + PscC - outer membrane protein for a type III secretion pathway   pscC           PseudoCAP(HancockOMP):
Contig53 1179543 1180568 + hypothetical protein - possible outer membrane protein             No notable sequence similarity except very low similarity to a Myxoma virus envelope protein PseudoCAP(HancockOMP):
Contig53 1180588 1182186 + probable outer membrane protein             Similar to E. coli OMP FadL for fatty acid transport and H. influenzae OMP P1. Two paralogs are present in the genome.  PseudoCAP(HancockOMP):
Contig53 1194920 1195972 + OUTER MEMBRANE PROTEIN OPRF PRECURSOR Porin F, protein F, major outer membrane protein F, OprF oprF   Major outer membrane protein that also binds peptidoglycan, stabilizing the outer membrane. Required for growth of P. aeruginosa in low osmolarity medium and for normal cell shape of P. aeruginosa. Also has porin activity (cation selective). Subcellular Location: Outer Membrane Predominantly transcribed from two promoters directly upstream of the gene (one major transcript that is RpoD dependent, and another that is SigX dependent. However, it is also co-trancribed with the upstream sigX gene at a low level (Brinkman et al., 1999 - Medline abstract not available yet). Co-transcribed with an upstream probable ECF sigma factor. 23 amino acid signal sequence. Probable 8 stranded beta barrel structure for first 154 to 163 amino acids of protein (Medline ref: 98324962) based on experimental studies. C-terminus shown to bind peptidoglycan (Medline ref 98324962). Two disulfide bonds present in a central domain of the protein. 100% similar to OprF [Pseudomonas aeruginosa PAO1]. Similar to OprF from other Pseudomonads. A member of the OmpA family of proteins. Similar at C-terminus to other peptidoglycan-binding proteins. PseudoCAP (HancockOMP): Extensively studied in P. aeruginosa PAO1. One of the most predominant outer membrane proteins visible in outer membrane preparations subjected to SDS-PAGE.
Contig53 1243379 1244983 - probable membrane-bound lytic murein transglycosylase d precursor             Most similar to E. coli membrane-bound lytic murein transglycosylase d precursor. PseudoCAP(HancockOMP):

 
 


Proposed peptidoglycan-binding proteins (not including those previously identified) are listed below. All share significant similarity to the C-terminus of PAL and OprF that have been previously demonstrated to bind peptidoglycan in this region (1998. J. Bacteriol. 180:3556-3562). Some of these sequences below may encode OMPs, however their cellular localization can not be well predicted at this time.
CONTIG FROM TO +/-  PROTEIN ALT PROT GENE ALT GENE HOMOLOGY
Contig48 163629 165023 - probable peptidoglycan-binding protein       Highly similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig48 317331 318680 - probable peptidoglycan-binding protein       Highly similar in Cterminal region of MotB, OprF and other peptidoglycan binding proteins that have been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig50 587249 588058 + probable peptidoglycan-binding protein       Highly similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig51 481005 482048 + probable peptidoglycan-binding protein       Similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig52 580121 580906 - probable peptidoglycan-binding protein       highly similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig52 768360 769499 + probable peptidoglycan-binding protein       Highly similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig53 331137 331646 + probable peptidoglycan-binding protein       Most similar to OprL. Highly similar in region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig53 400708 401340 + probable peptidoglycan-binding protein       highly similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig53 409147 410028 + probable peptidoglycan-binding protein       highly similar in Cterminal region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig53 486463 486969 - probable peptidoglycan-binding protein       highly similar in region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.
Contig53 865034 865924 + probable peptidoglycan-binding protein       Most similar to MotB. Highly similar in region of OprF and other peptidoglycan binding proteins that has been shown experimentally to bind peptidoglycan. Many be an outer membrane protein, but can't confirm this without further study.


R.E.W. Hancock Laboratory
Copyright © 1999 R.E.W. Hancock